PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008231582.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB
Protein Properties Length: 560aa    MW: 60824.5 Da    PI: 4.932
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008231582.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-173986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lv++vk++G g+W+++ ++ g+ R++k+c++rw ++l
   XP_008231582.1 39 KGPWTSAEDAILVEYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 86
                     79******************************************9986 PP

2Myb_DNA-binding53.74.8e-1792135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ l+v++++++G++ W++ a++++ gRt++++k++w++
   XP_008231582.1  92 KGAFTPEEEHLIVELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 135
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2363486IPR017930Myb domain
SMARTSM007172.1E-153888IPR001005SANT/Myb domain
SuperFamilySSF466892.4E-3038133IPR009057Homeodomain-like
PfamPF002492.0E-153986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-244093IPR009057Homeodomain-like
CDDcd001677.09E-124186No hitNo description
PROSITE profilePS5129426.35187141IPR017930Myb domain
SMARTSM007171.0E-1591139IPR001005SANT/Myb domain
PfamPF002496.0E-1692135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-2694140IPR009057Homeodomain-like
CDDcd001672.59E-1194135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MSRTTNESED GVLSKDQIES PMMDESNGGT GNGGIVLKKG PWTSAEDAIL VEYVKKHGEG  60
NWNAVQKHSG LFRCGKSCRL RWANHLRPNL KKGAFTPEEE HLIVELHAKM GNKWARMAAH  120
LPGRTDNEIK NYWNTRIKRR QRAGLPLYPP EVCLQALQES QQGQSSGGIN GADRAHHDSL  180
QTNSYEIPDV VFESLKGNNC VLPYVPEIPD LSASGVLMKG LSSSPYCGFM PPTMHRQKRL  240
RESTSLFSTS DGSFKNGFPQ FDHFQDDTCD KVGQSFGLSF PHDPDPTTKS PLSFGVIQGS  300
HSLSNGNSSA SKPTSGAVKL ELPSLQYPET DLGSWSTSPP PPLLESIDAF IQSPPPVGAF  360
ESDCASPRNS GLLDALLHEA KTLSSAKNLY SDKSSNSSSV TPGDIADSST LNICETEWED  420
YRDPISPLGH SATSLFSECT PISASGSSLD EPPPAETFTG CNVKPEPVDQ AWTPDKEKET  480
TPQLDYTRPD ALLASDWLEH STGFKDQGMT DSIASILGDD LATDYRHMAS GTSISNQVWG  540
LGSCLWNNMP AVCQMSSDLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31371405107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008231582.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLM5X3T10.0M5X3T1_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-138myb domain protein 33